PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.I02474.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family CPP
Protein Properties Length: 803aa    MW: 86295.9 Da    PI: 7.2976
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.I02474.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR413.8e-13504542341
             TCR   3 kkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkee 41 
                     ++ C+CkkskClk+YC Cfaa+++Cs  C+C++C N+++
  Pahal.I02474.1 504 CRCCSCKKSKCLKLYCACFAAKVYCSGLCSCQGCLNNHT 542
                     789*********************************987 PP

2TCR50.54e-16588627140
             TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                     ++k+gCnC+ks+ClkkYCeCf++g+ Cs +C+Ce+CkN+ 
  Pahal.I02474.1 588 RHKRGCNCRKSSCLKKYCECFQSGVGCSMSCRCESCKNSF 627
                     589***********************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011146.8E-12502543IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163434.339503628IPR005172CRC domain
PfamPF036386.1E-9505540IPR005172CRC domain
SMARTSM011141.5E-14588629IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.0E-11590626IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 803 aa     Download sequence    Send to blast
MDPPESPPAP AARPPSAAVS LYEDSPVFDF INSLSPIATP KPLGSAQSVQ LFKSSDLVPA  60
SSIFTSPQVN PQREYKPRTR YGYAQLSQGL SPICQRNQIG ISSCIELSGS PTIASENCSP  120
SEYATIYAQL SQGLSPICQR NQIGISSCIE LSGSPTIASE YCSPSEYAII LPSKWPQPIP  180
LGSEILGDAN KQDTDGKADH SPDVGHVKLS STCYDQNGID QLDPSTSGRN VQENELTKQY  240
NDDLAACSLN HLISRSGTGN AVMSKSDLSL EAQQLSWKLR SDKLFMPMDQ GNLEDSRRKL  300
FDGSTGCYIQ SAADDSHVYY AGAAEGVATN HDPKMLPSVI QSQLVSNEYF FDTFKIPSDG  360
MALSDHQCSG MHRRSLFNEK VWTSDLSGQS GSNLHHANIC GDNYMKPPRS PVYALPGIGL  420
HLNAVASNAS NNKPFTINPP LPPELNSPTT IVSCSETGLC SSEVNTLIHD DHSSQKTMPS  480
VDESCQESYK KKRRKLQNGD GGSCRCCSCK KSKCLKLYCA CFAAKVYCSG LCSCQGCLNN  540
HTHEETVSCI RKRTESRNPL AFAPTVTRAC DSGSDFGDDS NNTPASARHK RGCNCRKSSC  600
LKKYCECFQS GVGCSMSCRC ESCKNSFGKR KGALLLATEK MDKGAKAKGT RSKEEKLAFH  660
KQDVVSQSGD LTSTEDLFAT PSLEPCRSSI LLSSTCSEPP VSTVGCSSQL HNSQSPMKAD  720
VLFSPSETCA MEPILLDGSS NIQEVSSSCT TKVKVVSPNK KRVSSLQTGT GLSPIVRSGR  780
KLVLKSIPSF PSLTGDADSE PH*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1489493KKKRR
2489494KKKRRK
3490494KKRRK
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004982356.20.0PREDICTED: protein tesmin/TSO1-like CXC 2 isoform X1
RefseqXP_008665101.10.0PREDICTED: protein tesmin/TSO1-like CXC 2 isoform X1
TrEMBLK4A7550.0K4A755_SETIT; Uncharacterized protein
STRINGSi034711m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP147741921
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G22780.14e-53Tesmin/TSO1-like CXC domain-containing protein